PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01990.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 446aa    MW: 50469.9 Da    PI: 7.9401
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01990.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18e-102622991954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              F+   ++yp   ++e LAk++gLt++qV++WF N R +
  Rsa1.0_01990.1_g00004.1 262 FNHflHPYPRDLDKEMLAKQTGLTKSQVSNWFINARVR 299
                              5544589*****************************87 PP

2BELL107.11.1e-34141211272
                     BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              rqelq k+akL+s++e+V++ Ykqy++q+qtvissFe+ aglgsa++Yt++Al++iS++Fr++kd+i+ qi
  Rsa1.0_01990.1_g00004.1 141 RQELQLKRAKLISMVEKVEQIYKQYHDQMQTVISSFEQEAGLGSANSYTHMALQTISKKFRAVKDMICLQI 211
                              79******************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.7E-4479209IPR006563POX domain
PfamPF075268.7E-3390207IPR006563POX domain
PROSITE profilePS5007112.034240303IPR001356Homeobox domain
SMARTSM003896.9E-9243307IPR001356Homeobox domain
CDDcd000863.78E-11243304No hitNo description
SuperFamilySSF466893.64E-17244311IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-27246309IPR009057Homeodomain-like
PfamPF059205.0E-18260299IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MAVFFEGETE MREPSSDLFM VNLNPSSDQT MTINTHNNHF YNLYFAPQQH QRRMNKYEVL  60
DHIEQANSST ISTISNGRVA QSFRALAPTY LKVAQELLNE IVHVGNGSRG AKQEKRMNKE  120
SATYELYNGV GNINGEPGVC RQELQLKRAK LISMVEKVEQ IYKQYHDQMQ TVISSFEQEA  180
GLGSANSYTH MALQTISKKF RAVKDMICLQ IKRINNLLGE KECEGVSLAK QLGKMPHNHS  240
NAWRPQRGLP ETAVSVLRTW LFNHFLHPYP RDLDKEMLAK QTGLTKSQVS NWFINARVRV  300
WKPMVEEMYL EEMNIGESRK GGNLNEHGNK GSSSKQLCNN TTSDESSNLF LPPFHQGFIE  360
NETSMQNSFS SCSVMTFGKQ HVNQAKLIQF NGGFENHHAM VGNGVSLSLG MAHSCDQSFN  420
NIQFGSTSNE TKISGVYPSL TYQIMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B3e-16249307563Homeobox protein Meis2
3k2a_A3e-16249307563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013747083.10.0PREDICTED: BEL1-like homeodomain protein 5
SwissprotQ8S8970.0BLH5_ARATH; BEL1-like homeodomain protein 5
TrEMBLA0A078GYM00.0A0A078GYM0_BRANA; BnaA04g15670D protein
STRINGBra034335.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147491418
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27220.10.0BEL1-like homeodomain 5